PPARGC1A Peptide - middle region
PPARGC1A Peptide - middle region
Product Specifications
Product Name Alternative
LEM6, PGC1, PGC1A, PGC-1v, PPARGC1, PGC-1alpha, PGC-1 (alpha)
UniProt
Q9UBK2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001317680.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ALTDGDVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
045859-Biotin 100 µg
RPSA (Ribosomal Protein SA, CCLBP, MRAP, LR1, LRP/LR) (Biotin)
Sign In for Pricing
View Details 
ABC-X3085 1 Vial
Xpress™ Human TBX18 Over-expressing Stable Cell Line
Sign In for Pricing
View Details MBS9919756 Inquire
Cat Solute Carrier Family 17 Member 7 (SLC17A7) ELISA Kit
Sign In for Pricing
View Details 
