Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA5 Peptide - C-terminal region

HSPA5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BIP, MIF2, GRP78, HEL-S-89n

UniProt

P11021

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005338.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Fibroblast Growth Factor 21 (FGF21) ELISA Kit
RDR-FGF21-Ra-01 96 Tests

Rat Fibroblast Growth Factor 21 (FGF21) ELISA Kit

Sign In for Pricing
View Details
Rat Fibroblast Growth Factor 21 (FGF21) ELISA Kit
RDR-FGF21-Ra-02 48 Tests

Rat Fibroblast Growth Factor 21 (FGF21) ELISA Kit

Sign In for Pricing
View Details
Portable Spectrocolorimeter BPSP-1104
BPSP-1104 1 Unit

Portable Spectrocolorimeter BPSP-1104

Sign In for Pricing
View Details
ALS2CR13 (FAM117B) (NM_173511) Human Over-expression Lysate
LY432314 100 µg

ALS2CR13 (FAM117B) (NM_173511) Human Over-expression Lysate

Sign In for Pricing
View Details
Polystyrene A NH₂
HA40045002.100G 100 g

Polystyrene A NH₂

Sign In for Pricing
View Details
WDR61 Mouse Monoclonal Antibody [Clone ID: OTI1D4]
CF807588 100 µg

WDR61 Mouse Monoclonal Antibody [Clone ID: OTI1D4]

Sign In for Pricing
View Details