Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA5 Peptide - C-terminal region

HSPA5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BIP, MIF2, GRP78, HEL-S-89n

UniProt

P11021

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005338.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ɑ-Hydroxy-ω-Succinamic Acid PEG
133000-00-3.500MG 500 mg

Ɑ-Hydroxy-ω-Succinamic Acid PEG

Sign In for Pricing
View Details
MLC1SA (MYL6B) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B11]
TA811276AM 100 µL

MLC1SA (MYL6B) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B11]

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Mouse IgG3, κ Isotype Control[A112-3]
E-AB-F09753T3-01 25 µg

Elab Fluor® Violet 540 Mouse IgG3, κ Isotype Control[A112-3]

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Mouse IgG3, κ Isotype Control[A112-3]
E-AB-F09753T3-02 100 µg

Elab Fluor® Violet 540 Mouse IgG3, κ Isotype Control[A112-3]

Sign In for Pricing
View Details
LMX1A Human Gene Knockout Kit (CRISPR)
KN415375 1 Kit

LMX1A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RHAG (NM_000324) Human Over-expression Lysate
LY424797 100 µg

RHAG (NM_000324) Human Over-expression Lysate

Sign In for Pricing
View Details