FOS Peptide - middle region
FOS Peptide - middle region
Product Specifications
Product Name Alternative
P55, AP-1, C-FOS
UniProt
P01100
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_005243.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATEL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6213943-01 0.1 mL
SH3BGRL (SH3 Domain-binding Glutamic Acid-rich-like Protein, MGC117402) (MaxLight 550)
Sign In for Pricing
View Details MBS6213943-02 5x 0.1 mL
SH3BGRL (SH3 Domain-binding Glutamic Acid-rich-like Protein, MGC117402) (MaxLight 550)
Sign In for Pricing
View Details