FOS Peptide - middle region
FOS Peptide - middle region
Product Specifications
Product Name Alternative
P55, AP-1, C-FOS
UniProt
P01100
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_005243.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATEL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV737076 1.0 µg DNA
OR2V1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
Sign In for Pricing
View Details 
GTR15381338 1 Vial
Lentiviral human NMUR2 sgRNA gene knockout kit - Lentiviral human NMUR2 sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details TL303167V 500 µL Each
MRPL39 Human shRNA Lentiviral Particle (Locus ID 54148)
Sign In for Pricing
View Details