Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOD2 Peptide - N-terminal region

SOD2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

IPOB, IPO-B, MNSOD, MVCD6, Mn-SOD

UniProt

P04179

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000627.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTSRQLAPALGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C10orf129 sgRNA CRISPR Lentivector (Human) (Target 1)
K0281402 1.0 µg DNA

C10orf129 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Chromic carbonate tech.
3121560 1 Each

Chromic carbonate tech.

Sign In for Pricing
View Details
MREG Rabbit Polyclonal Antibody (PE)
orb498091 100 µL

MREG Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Integrin beta-1-A (itgb1-a), partial
MBS1221188 Inquire

Recombinant Xenopus laevis Integrin beta-1-A (itgb1-a), partial

Sign In for Pricing
View Details
Mouse Prostate tumor-overexpressed gene 1 protein (PTOV1) ELISA Kit
AE25150MO-01 48 Tests

Mouse Prostate tumor-overexpressed gene 1 protein (PTOV1) ELISA Kit

Sign In for Pricing
View Details
Mouse Prostate tumor-overexpressed gene 1 protein (PTOV1) ELISA Kit
AE25150MO-02 96 Tests

Mouse Prostate tumor-overexpressed gene 1 protein (PTOV1) ELISA Kit

Sign In for Pricing
View Details