Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOD2 Peptide - N-terminal region

SOD2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

IPOB, IPO-B, MNSOD, MVCD6, Mn-SOD

UniProt

P04179

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000627.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTSRQLAPALGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prl7b1 3'UTR Luciferase Stable Cell Line
TU216808 1.0 mL

Prl7b1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SCZD3 3'UTR Luciferase Stable Cell Line
TU022766 1.0 mL

SCZD3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
MLANA Protein Vector (Mouse) (pPM-C-His)
PV201057 500 ng

MLANA Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
DCK1 Antibody
MBS7150565 Inquire

DCK1 Antibody

Sign In for Pricing
View Details
Recombinant Suid herpesvirus 1 Envelope glycoprotein H (gH)
MBS1149452 Inquire

Recombinant Suid herpesvirus 1 Envelope glycoprotein H (gH)

Sign In for Pricing
View Details
Sgcz AAV siRNA Pooled Vector
43624164 1.0 µg

Sgcz AAV siRNA Pooled Vector

Sign In for Pricing
View Details