What is the catalog number for TMEM120A Peptide - middle region?

The catalog number for TMEM120A Peptide - middle region is orb1997958.

What sizes are available for TMEM120A Peptide - middle region?

TMEM120A Peptide - middle region is available in the following size(s): 100 µg.

Is TMEM120A Peptide - middle region in stock?

TMEM120A Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

TMEM120A Peptide - middle region

Product Specifications

Product Name Alternative

Tmpit, 2010310D06Rik

UniProt

Q5HZE2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_766129.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NGLYLSLVLGNVNVTLLSKQAKFAYKDEYEKFKLYLTIILIVISFTCRFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-32122JF549 0.1 mL

Rabbit Polyclonal WWOX Antibody [Janelia Fluor 549]

Sign In for Pricing

View Details

E19-8258-1 50 µg - 50 µL

SEPP1 Antibody

Sign In for Pricing

View Details

10R-5248 100 µL

PFKP antibody

Sign In for Pricing

View Details

TRV-0059212-01 20 µL

Monoclonal Antibody to Mucosal Addressin Cell Adhesion Molecule 1 (MAdCAM1)

Sign In for Pricing

View Details

TRV-0059212-02 100 µL

Monoclonal Antibody to Mucosal Addressin Cell Adhesion Molecule 1 (MAdCAM1)

Sign In for Pricing

View Details

TRV-0059212-03 200 µL

Monoclonal Antibody to Mucosal Addressin Cell Adhesion Molecule 1 (MAdCAM1)

Sign In for Pricing

View Details