Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM120A Peptide - middle region

TMEM120A Peptide - middle region

Product Specifications

Product Name Alternative

Tmpit, 2010310D06Rik

UniProt

Q5HZE2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_766129.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NGLYLSLVLGNVNVTLLSKQAKFAYKDEYEKFKLYLTIILIVISFTCRFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM100, CT (TMEM100, Transmembrane protein 100) (FITC) discontinued
042932-FITC 200 µL

TMEM100, CT (TMEM100, Transmembrane protein 100) (FITC) discontinued

Sign In for Pricing
View Details
Anti-FMNL3 Polyclonal Antibody
TMAB-06087-01 50 μL

Anti-FMNL3 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-FMNL3 Polyclonal Antibody
TMAB-06087-02 100 µL

Anti-FMNL3 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-FMNL3 Polyclonal Antibody
TMAB-06087-03 200 µL

Anti-FMNL3 Polyclonal Antibody

Sign In for Pricing
View Details
Ncapg ORF Vector (Mouse) (pORF)
ORF051077 1.0 µg DNA

Ncapg ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Mouse Podocin ELISA Kit
MBS007029-01 48 Well

Mouse Podocin ELISA Kit

Sign In for Pricing
View Details