Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CUX1 Peptide - middle region

CUX1 Peptide - middle region

Product Specifications

Product Name Alternative

CDP, Cux, Cutl1, Cux-1

UniProt

P53564

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001278162.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DPNNVEKLMDMKRMEKKAYMKRRHSSVSDSQPCEPPSVGIDYSQGASPQP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFEB Antibody
8C10428-AAT 50 µg

TFEB Antibody

Sign In for Pricing
View Details
Dibromoacetonitrile
TRC-D422760-1G 1 g

Dibromoacetonitrile

Sign In for Pricing
View Details
Uncoated Monkey CTSL (Cathepsin L) ELISA Kit
E-UNEL-MK0015-01 5x 96 Tests

Uncoated Monkey CTSL (Cathepsin L) ELISA Kit

Sign In for Pricing
View Details
Uncoated Monkey CTSL (Cathepsin L) ELISA Kit
E-UNEL-MK0015-02 15x 96 Tests

Uncoated Monkey CTSL (Cathepsin L) ELISA Kit

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS801277 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Bend5 Mouse Gene Knockout Kit (CRISPR)
KN502135 1 Kit

Bend5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details