Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CUX1 Peptide - middle region

CUX1 Peptide - middle region

Product Specifications

Product Name Alternative

CDP, Cux, Cutl1, Cux-1

UniProt

P53564

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001278162.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DPNNVEKLMDMKRMEKKAYMKRRHSSVSDSQPCEPPSVGIDYSQGASPQP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccl28 Mouse Gene Knockout Kit (CRISPR)
KN502792 1 Kit

Ccl28 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TIM3 / HAVCR2 / CD366 (Effector T-Cell Marker) (TIM3/3113), 0.2mg/mL
BNUB3113-100 1x 100 µL

TIM3 / HAVCR2 / CD366 (Effector T-Cell Marker) (TIM3/3113), 0.2mg/mL

Sign In for Pricing
View Details
MED18 (NM_001127350) Human Over-expression Lysate
LC426751 20 µg

MED18 (NM_001127350) Human Over-expression Lysate

Sign In for Pricing
View Details
Tau (Ab-181) Antibody
8B7244-AAT 50 µg

Tau (Ab-181) Antibody

Sign In for Pricing
View Details
CPNE2 (NM_152727) Human Recombinant Protein
TP308830M 100 µg

CPNE2 (NM_152727) Human Recombinant Protein

Sign In for Pricing
View Details
15-Keto Prostaglandin E1
TRC-K202050-5MG 5 mg

15-Keto Prostaglandin E1

Sign In for Pricing
View Details