Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATF6 Peptide - N-terminal region

ATF6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ACHM7, ATF6A

UniProt

P18850

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031374.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNLDFDLDLM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAV3 Protein Lysate (Rat) with C-HA Tag
31491036 100 µg

NAV3 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
PolQi2
E6541-5mg 5 mg

PolQi2

Sign In for Pricing
View Details
Ccdc125 ORF Vector (Rat) (pORF)
ORF064465 1.0 µg DNA

Ccdc125 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Mouse Anti Human IL-1 beta
MBS140161-01 0.5 mg

Mouse Anti Human IL-1 beta

Sign In for Pricing
View Details
Mouse Anti Human IL-1 beta
MBS140161-02 1 mg

Mouse Anti Human IL-1 beta

Sign In for Pricing
View Details
Mouse Anti Human IL-1 beta
MBS140161-03 5x 1 mg

Mouse Anti Human IL-1 beta

Sign In for Pricing
View Details