Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATF6 Peptide - N-terminal region

ATF6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ACHM7, ATF6A

UniProt

P18850

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031374.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNLDFDLDLM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli (strain SMS-3-5/SECEC) PLSB Polyclonal Antibody
MBS7184737 Inquire

Rabbit anti-Escherichia coli (strain SMS-3-5/SECEC) PLSB Polyclonal Antibody

Sign In for Pricing
View Details
KCNIP4 Rabbit Polyclonal Antibody (FITC)
orb2134396 100 µL

KCNIP4 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Human CLPS shRNA Plasmid
abx950861-01 150 µg

Human CLPS shRNA Plasmid

Sign In for Pricing
View Details
Human CLPS shRNA Plasmid
abx950861-02 300 µg

Human CLPS shRNA Plasmid

Sign In for Pricing
View Details
Cellular Tumor antigen p53 (TP53) Donkey ELISA Kit
C2781 96 Tests

Cellular Tumor antigen p53 (TP53) Donkey ELISA Kit

Sign In for Pricing
View Details
PDIK1L Antibody
A20189-50UG 50 µg

PDIK1L Antibody

Sign In for Pricing
View Details