Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL6ST Peptide - middle region

IL6ST Peptide - middle region

Product Specifications

Product Name Alternative

CD130, GP130, CDW130, IL-6RB

UniProt

P40189

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001177910.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDLKSLDLFKKEKINTEGHSSGIGGSSCMSSSRPSISSSDENESSQNTSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFRS3 (SRSF3) Rabbit Monoclonal Antibody
TA424108 100 µL

SFRS3 (SRSF3) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
RAP1GDS1 (NM_001100429) Human Over-expression Lysate
LY420268 100 µg

RAP1GDS1 (NM_001100429) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS503924 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
L-Tyrosine-Alpha,Beta,Beta,2,3,5,6-d7
TRC-T899995-1MG 1 mg

L-Tyrosine-Alpha,Beta,Beta,2,3,5,6-d7

Sign In for Pricing
View Details
Mouse Il21 activation kit by CRISPRa
GA206395 1 Kit

Mouse Il21 activation kit by CRISPRa

Sign In for Pricing
View Details
3-Aminopentan-2-ol
TRC-A226241-100MG 100 mg

3-Aminopentan-2-ol

Sign In for Pricing
View Details