What is the catalog number for MCM6 Peptide - C-terminal region?

The catalog number for MCM6 Peptide - C-terminal region is orb1997949.

What sizes are available for MCM6 Peptide - C-terminal region?

MCM6 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is MCM6 Peptide - C-terminal region in stock?

MCM6 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

MCM6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Mis5, P105MCM, MCG40308

UniProt

Q14566

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005906.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

201-09-2708 96 Tests

Rabbit collagen type I alpha 2 (COL1A2) ELISA Kit

Sign In for Pricing

View Details

NBP2-98498MFV450 0.1 mL

Rabbit Polyclonal TAPT1 Antibody [mFluor Violet 450 SE]

Sign In for Pricing

View Details

ELI-46210h 96 Tests

Human Extracellular sulfatase Sulf-1, SULF1 ELISA KIT

Sign In for Pricing

View Details

A01756-2-Cy3 100 µg/Vial

Anti-CD2AP Antibody Picoband® (Cy3 Conjugate)

Sign In for Pricing

View Details

LV731765 1.0 µg DNA

LINC00457 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing

View Details

orb750417 2 mL

CA1 Antibody

Sign In for Pricing

View Details