Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM6 Peptide - C-terminal region

MCM6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Mis5, P105MCM, MCG40308

UniProt

Q14566

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005906.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rcbtb1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
38731114 3x 1.0 µg

Rcbtb1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
SLC2A9 antibody
FNab10270 100 µg

SLC2A9 antibody

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica BURP domain-containing protein 17 (BURP17), partial
MBS1203253 Inquire

Recombinant Oryza sativa subsp. japonica BURP domain-containing protein 17 (BURP17), partial

Sign In for Pricing
View Details
Human α-L-iduronidase (IDUA) Elisa Kit
EK711551 96 Well

Human α-L-iduronidase (IDUA) Elisa Kit

Sign In for Pricing
View Details
FGFR4 antibody
70R-17296 50 μL

FGFR4 antibody

Sign In for Pricing
View Details
Human CCL28 (NM_001301873) AAV Particle
RC235853A1V 250 µL

Human CCL28 (NM_001301873) AAV Particle

Sign In for Pricing
View Details