Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEIS1 Peptide - middle region

MEIS1 Peptide - middle region

Product Specifications

UniProt

O00470

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002389.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lyophilized exosomes from B16F10 mouse cell line (mouse melanoma cell line) cell culture media
EXA-0822-CY18 2 Vials (> 1x 10^8 PaRoom Temperatureicles/Vial)

Lyophilized exosomes from B16F10 mouse cell line (mouse melanoma cell line) cell culture media

Sign In for Pricing
View Details
CTTNBP2 (h) -PR
sc-89339-PR 10 µM - 20 µL

CTTNBP2 (h) -PR

Sign In for Pricing
View Details
PTFE (Hydrophilic)
MF013-22-PTFE-HL 400 PCS/Box

PTFE (Hydrophilic)

Sign In for Pricing
View Details
TBX22 Rabbit pAb, BF700 conjugated
orb2873528 100 µL

TBX22 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
RBP1 Recombinant Protein
OPCD06664-10UG 10 µg

RBP1 Recombinant Protein

Sign In for Pricing
View Details
CD8 Rabbit Polyclonal Antibody (AP)
orb910501 100 µL

CD8 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details