MEIS1 Peptide - middle region
MEIS1 Peptide - middle region
Product Specifications
UniProt
O00470
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_002389.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV710392 1.0 µg DNA
GGT5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
Sign In for Pricing
View Details 
32083-05141 2x 75 µg
Human Syntaxin-6 AssayLite™ Antibody (FITC Conjugate)
Sign In for Pricing
View Details abx322061-01 20 µL
Chondroitin Sulfate Proteoglycan 4 (CSPG4) Antibody
Sign In for Pricing
View Details abx322061-02 50 µL
Chondroitin Sulfate Proteoglycan 4 (CSPG4) Antibody
Sign In for Pricing
View Details