Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMY1A Peptide - middle region

AMY1A Peptide - middle region

Product Specifications

Product Name Alternative

AMY1

UniProt

P04746

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001008219.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNND

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Triosephosphate Isomerase Antibody
RC-15048-01 50 μL

Recombinant Triosephosphate Isomerase Antibody

Sign In for Pricing
View Details
Recombinant Triosephosphate Isomerase Antibody
RC-15048-02 100 µL

Recombinant Triosephosphate Isomerase Antibody

Sign In for Pricing
View Details
Recombinant Triosephosphate Isomerase Antibody
RC-15048-03 1 mL

Recombinant Triosephosphate Isomerase Antibody

Sign In for Pricing
View Details
Peretinoin
TRC-P286120-5MG 5 mg

Peretinoin

Sign In for Pricing
View Details
Human CEP120 activation kit by CRISPRa
GA115857 1 Kit

Human CEP120 activation kit by CRISPRa

Sign In for Pricing
View Details
QuicKey Pro Mouse CRP (C-Reactive Protein) ELISA Kit
E-OSEL-M0016-01 24 Tests

QuicKey Pro Mouse CRP (C-Reactive Protein) ELISA Kit

Sign In for Pricing
View Details