Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMY1A Peptide - middle region

AMY1A Peptide - middle region

Product Specifications

Product Name Alternative

AMY1

UniProt

P04746

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001008219.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNND

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(9Z,26Z)-Pentatriaconta-9,26-dien-18-one
TRC-P284990-5MG 5 mg

(9Z,26Z)-Pentatriaconta-9,26-dien-18-one

Sign In for Pricing
View Details
TentaGel® MB TRT-OH
MB160120.50G 50 g

TentaGel® MB TRT-OH

Sign In for Pricing
View Details
ZNF18 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7A8]
TA810110AM 100 µL

ZNF18 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7A8]

Sign In for Pricing
View Details
IL20 Rabbit Polyclonal Antibody
AP20589PU-N 100 µg

IL20 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GALE (Center) Rabbit Polyclonal Antibody
AP17410PU-N 400 µL

GALE (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
alpha sarcoglycan Recombinant Rabbit Monoclonal Antibody [JA51-81]
ET1704-25 100 µL

alpha sarcoglycan Recombinant Rabbit Monoclonal Antibody [JA51-81]

Sign In for Pricing
View Details