What is the catalog number for SOS1 Peptide - middle region?

The catalog number for SOS1 Peptide - middle region is orb1997945.

What sizes are available for SOS1 Peptide - middle region?

SOS1 Peptide - middle region is available in the following size(s): 100 µg.

Is SOS1 Peptide - middle region in stock?

SOS1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

SOS1 Peptide - middle region

Product Specifications

Product Name Alternative

GF1, HGF, NS4, GGF1, GINGF

UniProt

Q07889

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005624.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PRNPKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

45459101 1 µg

SRGAP3 AAV Vector (Human) (CMV)

Sign In for Pricing

View Details

TA384669 100 µL

Lamin B2 (LMNB2) Rabbit Monoclonal Antibody [Clone ID: R02-9I7]

Sign In for Pricing

View Details

SI009182B 1 Each

Human MAP1B Pre-designed siRNA Set B

Sign In for Pricing

View Details

039463-ML550 100 µL

OR5W2, CT (OR5W2, OR5W2P, OR5W3P, Olfactory receptor 5W2, Olfactory receptor 5W3, Olfactory receptor OR11-155) (MaxLight 550) discontinued

Sign In for Pricing

View Details

OR1070200-01 100 mg

7,9-Dimesityl-7H-acenaphtho[1,2-d]imidazol-9-ium chloride

Sign In for Pricing

View Details

OR1070200-02 250 mg

7,9-Dimesityl-7H-acenaphtho[1,2-d]imidazol-9-ium chloride

Sign In for Pricing

View Details