Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNGR1 Peptide - middle region

IFNGR1 Peptide - middle region

Product Specifications

Product Name Alternative

CD119, IFNGR, IMD27A, IMD27B

UniProt

P15260

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000407.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carbohydrate sulfotransferase 4 (CHST4) Rabbit Polyclonal Antibody
TA368284 100 µL

Carbohydrate sulfotransferase 4 (CHST4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant EAAT1 Monoclonal Antibody
AN301072L-01 50 µL

Recombinant EAAT1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant EAAT1 Monoclonal Antibody
AN301072L-02 100 µL

Recombinant EAAT1 Monoclonal Antibody

Sign In for Pricing
View Details
C14orf50 (PPP1R36) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C10]
TA809454AM 100 µL

C14orf50 (PPP1R36) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C10]

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2145), CF594 conjugate, 0.1mg/mL
BNC942145-500 1x 500 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2145), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Precast Protein Plus Gel,4-20%,10 wells,Hepes-Tris,10 well
36250ES10 10 Gels (1 Box )

Precast Protein Plus Gel,4-20%,10 wells,Hepes-Tris,10 well

Sign In for Pricing
View Details