Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNGR1 Peptide - middle region

IFNGR1 Peptide - middle region

Product Specifications

Product Name Alternative

CD119, IFNGR, IMD27A, IMD27B

UniProt

P15260

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000407.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nucleophosmin (Acute Myeloid Leukemia Marker) (rNPM1/1901), Biotin conjugate, 0.1mg/mL
BNCB3807-500 1x 500 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (rNPM1/1901), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TBC1D25 (NM_002536) Human Recombinant Protein
TP321238M 100 µg

TBC1D25 (NM_002536) Human Recombinant Protein

Sign In for Pricing
View Details
Lamin A (LMNA) Mouse Monoclonal Antibody [Clone ID: 4E7]
AM06658SU-N 100 µL

Lamin A (LMNA) Mouse Monoclonal Antibody [Clone ID: 4E7]

Sign In for Pricing
View Details
POTEG Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F6]
TA808190AM 100 µL

POTEG Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F6]

Sign In for Pricing
View Details
C10orf58 Recombinant Mouse monoclonal Antibody
HA610088 100 µg

C10orf58 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
CD66 (CEA) (C66/1009), CF740 conjugate, 0.1mg/mL
BNC741009-500 1x 500 µL

CD66 (CEA) (C66/1009), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details