Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGFG1 Peptide - C-terminal region

AGFG1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HRB, RAB, RIP

UniProt

P52594

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001128659.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NGAGFAAFGQTKPVVTPFGQVAAAGVSSNPFMTGAPTGQFPTGSSSTNPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human POLR2G, His-tagged
POLR2G-1845H 25 µg

Recombinant Human POLR2G, His-tagged

Sign In for Pricing
View Details
NRBP1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
32154111 3x 1.0 µg

NRBP1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
TCP1 epsilon (CCT5) Rabbit Polyclonal Antibody
TA334424 100 µL

TCP1 epsilon (CCT5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Gentisic acid sodium salt
sc-218569 250 mg

Gentisic acid sodium salt

Sign In for Pricing
View Details
PPX Mouse Monoclonal Antibody
orb1474393-01 30 µL

PPX Mouse Monoclonal Antibody

Sign In for Pricing
View Details
PPX Mouse Monoclonal Antibody
orb1474393-02 50 μL

PPX Mouse Monoclonal Antibody

Sign In for Pricing
View Details