Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGFG1 Peptide - C-terminal region

AGFG1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HRB, RAB, RIP

UniProt

P52594

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001128659.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NGAGFAAFGQTKPVVTPFGQVAAAGVSSNPFMTGAPTGQFPTGSSSTNPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDHC (Succinate Dehydrogenase Complex, Subunit C, Integral Membrane Protein, 15kD, CYB560, CYBL, PGL3, QPS1, SDH3) (MaxLight 750) discontinued
251470-ML750 100 µL

SDHC (Succinate Dehydrogenase Complex, Subunit C, Integral Membrane Protein, 15kD, CYB560, CYBL, PGL3, QPS1, SDH3) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Bombinin-like peptide 3
T82832-01 5 mg

Bombinin-like peptide 3

Sign In for Pricing
View Details
Bombinin-like peptide 3
T82832-02 50 mg

Bombinin-like peptide 3

Sign In for Pricing
View Details
tert-Octyl Mercaptan
TRC-O141595-500MG 500 mg

tert-Octyl Mercaptan

Sign In for Pricing
View Details
Cystatin C Mouse Monoclonal Antibody (APC)
orb1000490 100 µL

Cystatin C Mouse Monoclonal Antibody (APC)

Sign In for Pricing
View Details
Vented Overcap, Sterile, Bag Package, 1 pc/pack, 20 packs/bag, 20 pcs/case
740913 20 PCS/CS

Vented Overcap, Sterile, Bag Package, 1 pc/pack, 20 packs/bag, 20 pcs/case

Sign In for Pricing
View Details