PSMF1 Peptide - C-terminal region
PSMF1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
PI31
UniProt
Q92530
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_006805.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDHLPPPGYDDMYL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
039861-FITC 200 µL
PDZD3, ID (PDZD3, IKEPP, NHERF4, PDZK2, Na (+) /H (+) exchange regulatory cofactor NHE-RF4, Intestinal and kidney-enriched PDZ protein, Natrium-phosphate cotransporter IIa C-terminal-associated protein 2, PDZ domain-containing protein 2, PDZ domain-containing protein 3, Sodium-hydrogen exchanger regulatory factor 4) (FITC) discontinued
Sign In for Pricing
View Details 
P3110-99R-FITC 200 µL
PARK7, NT (Protein DJ-1, Oncogene DJ1, Parkinson Disease Protein 7) (FITC) discontinued
Sign In for Pricing
View Details 