Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMF1 Peptide - C-terminal region

PSMF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PI31

UniProt

Q92530

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006805.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDHLPPPGYDDMYL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNAP 25 (h) -PR
sc-36517-PR 10 µM - 20 µL

SNAP 25 (h) -PR

Sign In for Pricing
View Details
Sclerostin, Recombinant, Rat, aa29-213, His-Tag, Myc-Tag
586245-01 20 µg

Sclerostin, Recombinant, Rat, aa29-213, His-Tag, Myc-Tag

Sign In for Pricing
View Details
Sclerostin, Recombinant, Rat, aa29-213, His-Tag, Myc-Tag
586245-02 100 µg

Sclerostin, Recombinant, Rat, aa29-213, His-Tag, Myc-Tag

Sign In for Pricing
View Details
Goat Anti-Mouse IgG2a - FITC
CSA2310-01 100 µL

Goat Anti-Mouse IgG2a - FITC

Sign In for Pricing
View Details
Goat Anti-Mouse IgG2a - FITC
CSA2310-02 500 μL

Goat Anti-Mouse IgG2a - FITC

Sign In for Pricing
View Details
Goat Anti-Mouse IgG2a - FITC
CSA2310-03 1 mL

Goat Anti-Mouse IgG2a - FITC

Sign In for Pricing
View Details