What is the catalog number for MBIP Peptide - C-terminal region?

The catalog number for MBIP Peptide - C-terminal region is orb1997934.

What sizes are available for MBIP Peptide - C-terminal region?

MBIP Peptide - C-terminal region is available in the following size(s): 100 µg.

Is MBIP Peptide - C-terminal region in stock?

MBIP Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

MBIP Peptide - C-terminal region

Product Specifications

UniProt

Q9NS73

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001138363.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ISPEYFQSVSFSGKRRKVQPPQQNYSLAELDEKISALKQALLRKSREAES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

orb580334 100 µL

PSMD8 Rabbit Polyclonal Antibody

Sign In for Pricing

View Details

T8494-01-APC 100 µL

TRIP6 (Thyroid Receptor Interacting Protein 6, Thyroid Hormone Receptor Interactor 6, Thyroid Receptor-interacting Protein 6, TRI6, TRIP 6, TRIP-6, MGC10556, MGC10558, MGC29959, MGC3837, MGC4423, OIP 1, OIP1, OIP-1, OPA-interacting Protein 1, Zyxin-related Protein 1, ZRP 1, ZRP1, ZRP-1) (APC)

Sign In for Pricing

View Details

C15394-100uL 100 µL

Desmoplakin I+II Antibody [M24F24]

Sign In for Pricing

View Details

MR201740L4 10 µg

Arl8a (NM_026823) Mouse Tagged Lenti ORF Clone

Sign In for Pricing

View Details

28941-01 50 µL

KLHL41 Polyclonal Antibody

Sign In for Pricing

View Details

28941-02 100 µL

KLHL41 Polyclonal Antibody

Sign In for Pricing

View Details