What is the catalog number for MBIP Peptide - C-terminal region?

The catalog number for MBIP Peptide - C-terminal region is orb1997934.

What sizes are available for MBIP Peptide - C-terminal region?

MBIP Peptide - C-terminal region is available in the following size(s): 100 µg.

Is MBIP Peptide - C-terminal region in stock?

MBIP Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

MBIP Peptide - C-terminal region

Product Specifications

UniProt

Q9NS73

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001138363.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ISPEYFQSVSFSGKRRKVQPPQQNYSLAELDEKISALKQALLRKSREAES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MR202122A1V 250 µL

Mouse Mettl26 (NM_026686) AAV Particle

Sign In for Pricing

View Details

HP218057 200 Reactions

POU5F2 Human qPCR Primer Pair (NM_153216)

Sign In for Pricing

View Details

CSB-CL868369HU1 10 μg Plasmid + 200 μL Glycerol

MTCH1

Sign In for Pricing

View Details

37380111 3x 1.0 µg

PPM1B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing

View Details

125679-ML750 100 µL

DCTD (Deoxycytidylate Deaminase, dCMP Deaminase) (MaxLight 750) discontinued

Sign In for Pricing

View Details

E001086 1 Each

Human ADM2 ELISA Kit

Sign In for Pricing

View Details