MPP6 Peptide - middle region
MPP6 Peptide - middle region
Product Specifications
Product Name Alternative
VAM1, p55T, PALS2, VAM-1
UniProt
Q9NZW5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_057531.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKIDSI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
FAB1345T-100UG 100 µg
Human Integrin alpha 3/CD49c Alexa Fluor 594 Antibody
Sign In for Pricing
View Details 
RC225648L2 10 µg
Tau (MAPT) (NM_001123067) Human Tagged Lenti ORF Clone
Sign In for Pricing
View Details 322235 100 µL
LDOC1L (Protein LDOC1L, Leucine zipper protein down-regulated in cancer cells-like, Mammalian retrotransposon-derived protein 6, LDOCL, MAR6)
Sign In for Pricing
View Details 
MBS7143889 Inquire
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At1g21890 Polyclonal Antibody
Sign In for Pricing
View Details