MPP6 Peptide - middle region
MPP6 Peptide - middle region
Product Specifications
Product Name Alternative
VAM1, p55T, PALS2, VAM-1
UniProt
Q9NZW5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_057531.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKIDSI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1449433-01 0.02 mg (E-Coli)
Recombinant Shigella sonnei GTP cyclohydrolase-2 (ribA)
Sign In for Pricing
View Details MBS1449433-02 0.1 mg (E-Coli)
Recombinant Shigella sonnei GTP cyclohydrolase-2 (ribA)
Sign In for Pricing
View Details MBS1449433-03 0.02 mg (Yeast)
Recombinant Shigella sonnei GTP cyclohydrolase-2 (ribA)
Sign In for Pricing
View Details