Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK4 Peptide - middle region

CDK4 Peptide - middle region

Product Specifications

UniProt

P35426

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_446045.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDLMRQFLSGLDF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human MUC5B Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA)
IRBAHUMUC5BAP789120UL 1 Each

Rabbit Anti Human MUC5B Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA)

Sign In for Pricing
View Details
Cleaved-C1R (I464) Antibody
CSB-PA000016-01 50 µg

Cleaved-C1R (I464) Antibody

Sign In for Pricing
View Details
Cleaved-C1R (I464) Antibody
CSB-PA000016-02 100 µg

Cleaved-C1R (I464) Antibody

Sign In for Pricing
View Details
GRP170 Antibody
E38QA3201 100 µL

GRP170 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Jam3 shRNA (UAS) - Lentiviral mouse Jam3 shRNA (UAS, iRFP) plasmid
GTR15233200 1 Vial

Lentiviral mouse Jam3 shRNA (UAS) - Lentiviral mouse Jam3 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
[KO Validated] P21 Polyclonal Antibody
E92691a 100 µL

[KO Validated] P21 Polyclonal Antibody

Sign In for Pricing
View Details