CDK4 Peptide - middle region
CDK4 Peptide - middle region
Product Specifications
UniProt
P35426
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_446045.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDLMRQFLSGLDF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A13685-10mM-D 10 mM x 1mL in DMSO
Xanomeline oxalate 10mM * 1mL in DMSO
Sign In for Pricing
View Details 30378061 1.0 µg DNA
MPV17L2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details RC200465L3V 200 µL
HEXB (NM_000521) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 37798141 1x 10^6 Cells / 1.0 mL
PRR22 CRISPR Knock Out 293T Cell Line (Human)
Sign In for Pricing
View Details