What is the catalog number for MMP12 Peptide - middle region?

The catalog number for MMP12 Peptide - middle region is orb1997929.

What sizes are available for MMP12 Peptide - middle region?

MMP12 Peptide - middle region is available in the following size(s): 100 µg.

Is MMP12 Peptide - middle region in stock?

MMP12 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

MMP12 Peptide - middle region

Product Specifications

Product Name Alternative

MME, Mmel, AV378681

UniProt

P34960

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001307005.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STFCHQSLSFDAVTTVGEKIFFFKDWFFWWKLPGSPATNITSISSIWPSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PV280076 500 ng

LRRC49 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing

View Details

AAP44499-100UG 100 µg

GPNMB Peptide (AAP44499)

Sign In for Pricing

View Details

37429164 1.0 µg

Ppp1r1c AAV siRNA Pooled Vector

Sign In for Pricing

View Details

CX1-C5222-50ug 50 µg

Cynomolgus CX3CL1 / Fractalkine Protein, His Tag (MALS verified)

Sign In for Pricing

View Details

SI007537A 1 Each

Human IHO1 Pre-designed siRNA Set A

Sign In for Pricing

View Details

NBP1-91069-25ul 25 µL

Rabbit Polyclonal FAM187A Antibody

Sign In for Pricing

View Details