MMP12 Peptide - middle region
MMP12 Peptide - middle region
Product Specifications
Product Name Alternative
MME, Mmel, AV378681
UniProt
P34960
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001307005.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: STFCHQSLSFDAVTTVGEKIFFFKDWFFWWKLPGSPATNITSISSIWPSI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV762809 1.0 µg DNA
HLA-V Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details TRV-0060188-01 20 µL
Monoclonal Antibody to Pleiomorphic Adenoma Gene Like Protein 1 (PLAGL1)
Sign In for Pricing
View Details TRV-0060188-02 100 µL
Monoclonal Antibody to Pleiomorphic Adenoma Gene Like Protein 1 (PLAGL1)
Sign In for Pricing
View Details TRV-0060188-03 200 µL
Monoclonal Antibody to Pleiomorphic Adenoma Gene Like Protein 1 (PLAGL1)
Sign In for Pricing
View Details TRV-0060188-04 1 mL
Monoclonal Antibody to Pleiomorphic Adenoma Gene Like Protein 1 (PLAGL1)
Sign In for Pricing
View Details