RBPJ Peptide - middle region
RBPJ Peptide - middle region
Product Specifications
Product Name Alternative
CBF1, RBP-J, RBPjk, Igkjrb, Rbpsuh, Igkrsbp, AI843960, RBP-Jkappa, RBP-J kappa
UniProt
P31266
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001074396.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ARP74158_P050 100 µL
PYGM Antibody - C-terminal region (ARP74158_P050)
Sign In for Pricing
View Details 
ABP-S-04192 5 Plates
Human; Mouse; Rat ACTB Matched Antibody Pair Set [ABP-S-04192]
Sign In for Pricing
View Details