Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBPJ Peptide - middle region

RBPJ Peptide - middle region

Product Specifications

Product Name Alternative

CBF1, RBP-J, RBPjk, Igkjrb, Rbpsuh, Igkrsbp, AI843960, RBP-Jkappa, RBP-J kappa

UniProt

P31266

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001074396.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Duck beta-Lactamase Inhibitor ELISA Kit
MBS090464 Inquire

Duck beta-Lactamase Inhibitor ELISA Kit

Sign In for Pricing
View Details
RGD1564927 Recombinant Protein (Rat)
RP225695 100 µg

RGD1564927 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Rabbit anti-INSRR Antibody
YLD4382-01 50 µL

Rabbit anti-INSRR Antibody

Sign In for Pricing
View Details
Rabbit anti-INSRR Antibody
YLD4382-02 100 µL

Rabbit anti-INSRR Antibody

Sign In for Pricing
View Details
Anti-TAX1BP1 Antibody
MBS8323161-01 0.03 mL

Anti-TAX1BP1 Antibody

Sign In for Pricing
View Details
Anti-TAX1BP1 Antibody
MBS8323161-02 0.05 mL

Anti-TAX1BP1 Antibody

Sign In for Pricing
View Details