Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA8 Peptide - middle region

HSPA8 Peptide - middle region

Product Specifications

Product Name Alternative

Hsc70, Hsc71, Hsc73, Hsp73, Hspa10, 2410008N15Rik

UniProt

P63017

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_112442.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL23R, CT (IL23R, Interleukin-23 receptor) (MaxLight 405) discontinued
036998-ML405 100 µL

IL23R, CT (IL23R, Interleukin-23 receptor) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rabbit anti-GAD2 Antibody
MBS4510082-01 0.05 mL

Rabbit anti-GAD2 Antibody

Sign In for Pricing
View Details
Rabbit anti-GAD2 Antibody
MBS4510082-02 0.1 mL

Rabbit anti-GAD2 Antibody

Sign In for Pricing
View Details
Rabbit anti-GAD2 Antibody
MBS4510082-03 5x 0.1 mL

Rabbit anti-GAD2 Antibody

Sign In for Pricing
View Details
CdcA4 CRISPR/Cas9 KO Plasmid (m)
sc-428163 20 µg

CdcA4 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
CD80 Antibody (RPE-Cy5)
GWB-CA2BB2 100 Tests / 2 mL

CD80 Antibody (RPE-Cy5)

Sign In for Pricing
View Details