Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA8 Peptide - middle region

HSPA8 Peptide - middle region

Product Specifications

Product Name Alternative

Hsc70, Hsc71, Hsc73, Hsp73, Hspa10, 2410008N15Rik

UniProt

P63017

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_112442.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat FGF21 (Fibroblast Growth Factor 21) ELISA Kit
ER22152 96 Tests

Rat FGF21 (Fibroblast Growth Factor 21) ELISA Kit

Sign In for Pricing
View Details
AdmiRa-mmu-miR-6938-3p Virus
mm1600 250 µL

AdmiRa-mmu-miR-6938-3p Virus

Sign In for Pricing
View Details
FEZF1 Protein Vector (Human) (pPB-N-His)
PV078294 500 ng

FEZF1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
CSPG6 (Structural Maintenance of Chromosomes 3, BAM, BMH, CDLS3, CSPG6, HCAP, SMC3L1)
245019 100 µg

CSPG6 (Structural Maintenance of Chromosomes 3, BAM, BMH, CDLS3, CSPG6, HCAP, SMC3L1)

Sign In for Pricing
View Details
Mouse Protein TANC2 (TANC2) ELISA Kit
orb1656558-01 48 Tests

Mouse Protein TANC2 (TANC2) ELISA Kit

Sign In for Pricing
View Details
Mouse Protein TANC2 (TANC2) ELISA Kit
orb1656558-02 96 Tests

Mouse Protein TANC2 (TANC2) ELISA Kit

Sign In for Pricing
View Details