What is the catalog number for RAX Peptide - middle region?

The catalog number for RAX Peptide - middle region is orb1997923.

What sizes are available for RAX Peptide - middle region?

RAX Peptide - middle region is available in the following size(s): 100 µg.

Is RAX Peptide - middle region in stock?

RAX Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

RAX Peptide - middle region

Product Specifications

Product Name Alternative

Rx, ey1, ey-1, 7530406A22Rik, E130303K03Rik

UniProt

O35602

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_038861.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ATRPCYPKEQGEARPSPGLSVGPAAGDSKLSEEEPPKKKHRRNRTTFTTY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

815931 Card of 1 Pictogram(s)

STNL E013-210x297-AL-CRD/1 AC Signs

Sign In for Pricing

View Details

sc-514917 PE 200 µg/mL

ZNF474 (C-8) PE

Sign In for Pricing

View Details

bs-12914R-BF680 100 µL

Phospho-c-Kit (Tyr730) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing

View Details

OR1053513-01 1 g

2- (4-Chloro-2-methoxyphenyl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane

Sign In for Pricing

View Details

OR1053513-02 5 g

2- (4-Chloro-2-methoxyphenyl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane

Sign In for Pricing

View Details

OR1059842-01 100 mg

4-Ethynyltetrahydro-2H-thiopyran

Sign In for Pricing

View Details