RAX Peptide - middle region
RAX Peptide - middle region
Product Specifications
Product Name Alternative
Rx, ey1, ey-1, 7530406A22Rik, E130303K03Rik
UniProt
O35602
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_038861.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ATRPCYPKEQGEARPSPGLSVGPAAGDSKLSEEEPPKKKHRRNRTTFTTY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9008027 Inquire
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) RPP3A Polyclonal Antibody
Sign In for Pricing
View Details 
GTR15361842 1 Vial
Lentiviral human INAVA sgRNA gene knockout kit - Lentiviral human INAVA sgRNA gene knockout kit (25)
Sign In for Pricing
View Details 