Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UPF1 Peptide - C-terminal region

UPF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NORF1, Rent1, Upflp, PNORF-1, B430202H16Rik

UniProt

Q9EPU0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001116301.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GQANGPAAGRGTPKTKTGRGGRQKNRFGLPGPSQTTLPNSQASQDVASQP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PANK2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H9]
TA501321AM 100 µL

PANK2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H9]

Sign In for Pricing
View Details
ARSG Human Gene Knockout Kit (CRISPR)
KN401967 1 Kit

ARSG Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Neurofilament (NEFL) Rabbit Polyclonal Antibody
AP20786PU-N 100 µg

Neurofilament (NEFL) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Primer Panel
HPP6005B 10x 96 Pre-Arrayed Plates

Primer Panel

Sign In for Pricing
View Details
MHC II (HLA-DQ) (SPV-L3), CF647 conjugate, 0.1mg/mL
BNC470200-100 1x 100 µL

MHC II (HLA-DQ) (SPV-L3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tenascin C (Stromal Marker For Epithelial Malignancy) (TNC/2981R), CF405S conjugate, 0.1mg/mL
BNC042981-500 1x 500 µL

Tenascin C (Stromal Marker For Epithelial Malignancy) (TNC/2981R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details