What is the catalog number for HHEX Peptide - middle region?

The catalog number for HHEX Peptide - middle region is orb1997921.

What sizes are available for HHEX Peptide - middle region?

HHEX Peptide - middle region is available in the following size(s): 100 µg.

Is HHEX Peptide - middle region in stock?

HHEX Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

HHEX Peptide - middle region

Product Specifications

Product Name Alternative

Hex, Prh, Hex1, Prhx, Hhex-rs2

UniProt

P43120

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032271.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKDALDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LH17380V 100 µg

IRF5 (NM_032643) Human Over-expression Lysate

Sign In for Pricing

View Details

RR202556L4V 200 µL

Il21r (NM_001012469) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing

View Details

AM02169PU-S 10 µg

ANP (NPPA) (12-25) Mouse Monoclonal Antibody [Clone ID: M14/19/H3]

Sign In for Pricing

View Details

TL710508V 500 µL Each

Lin7b Rat shRNA Lentiviral Particle (Locus ID 60377)

Sign In for Pricing

View Details

PPT-13633 100 µg

Human LCAT Recombinant Protein

Sign In for Pricing

View Details

GTR15390501 1 Vial

Lentiviral human ZWILCH sgRNA gene knockout kit - Lentiviral human ZWILCH sgRNA gene knockout kit (25)

Sign In for Pricing

View Details