Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HHEX Peptide - middle region

HHEX Peptide - middle region

Product Specifications

Product Name Alternative

Hex, Prh, Hex1, Prhx, Hhex-rs2

UniProt

P43120

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032271.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKDALDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vars2 (NM_213563) Rat Tagged Lenti ORF Clone
RR206349L3 10 µg

Vars2 (NM_213563) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PDCD1 Antibody
orb1237984 0.1 mg

PDCD1 Antibody

Sign In for Pricing
View Details
TTC26 AAV Vector (Human) (CMV)
48676102 1 µg

TTC26 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Tmprss11b (NM_001004020) Rat Tagged ORF Clone
RR204498 10 µg

Tmprss11b (NM_001004020) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Human LLPH siRNA
abx922655-01 15 nmol

Human LLPH siRNA

Sign In for Pricing
View Details
Human LLPH siRNA
abx922655-02 30 nmol

Human LLPH siRNA

Sign In for Pricing
View Details