What is the catalog number for GJB2 Peptide - N-terminal region?

The catalog number for GJB2 Peptide - N-terminal region is orb1997917.

What sizes are available for GJB2 Peptide - N-terminal region?

GJB2 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is GJB2 Peptide - N-terminal region in stock?

GJB2 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

GJB2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Cx26, Cnx26, Gjb-2, AI325222

UniProt

Q00977

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032151.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DWGTLQSILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-150747-SH 20 µg

Olfr315 shRNA Plasmid (m)

Sign In for Pricing

View Details

MBS9905455 Inquire

Pigeon Transmembrane and Immunoglobulin Domain-Containing Protein 2 (TMIGD2) ELISA Kit

Sign In for Pricing

View Details

BZ47264 1 Vial

PLV3-U6-HAGH (human) -shRNA2-Puro

Sign In for Pricing

View Details

bsm-62101R-BF647 100 µL

FANCA Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing

View Details

AAP53476-100UG 100 µg

ZPBP2 Peptide - N-terminal region (AAP53476)

Sign In for Pricing

View Details

39086016 1.0 µg DNA

RGD1309906 ORF Vector (Rat) (pORF)

Sign In for Pricing

View Details