What is the catalog number for GJB2 Peptide - N-terminal region?

The catalog number for GJB2 Peptide - N-terminal region is orb1997917.

What sizes are available for GJB2 Peptide - N-terminal region?

GJB2 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is GJB2 Peptide - N-terminal region in stock?

GJB2 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

GJB2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Cx26, Cnx26, Gjb-2, AI325222

UniProt

Q00977

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032151.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DWGTLQSILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E45Ra00105V-2 50 µL

Ki67 (MKI67) Rat Monoclonal Antibody [Clone 1D9]

Sign In for Pricing

View Details

MBS2151097-01 0.1 mL

APC_Cy7-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)

Sign In for Pricing

View Details

MBS2151097-02 0.2 mL

APC_Cy7-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)

Sign In for Pricing

View Details

MBS2151097-03 0.5 mL

APC_Cy7-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)

Sign In for Pricing

View Details

MBS2151097-04 1 mL

APC_Cy7-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)

Sign In for Pricing

View Details

MBS2151097-05 5 mL

APC_Cy7-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)

Sign In for Pricing

View Details