Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKCB Peptide - C-terminal region

PRKCB Peptide - C-terminal region

Product Specifications

Product Name Alternative

PKCB, PRKCB1, PRKCB2, PKC-beta

UniProt

P05771

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_997700.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRDTSNF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stearidonic Acid Ethyl Ester
TRC-S686460-10MG 10 mg

Stearidonic Acid Ethyl Ester

Sign In for Pricing
View Details
Human HB-EGF (NP_001936) VersaClone cDNA
RDC1504 10 µg

Human HB-EGF (NP_001936) VersaClone cDNA

Sign In for Pricing
View Details
Pipetman Comfort Handle Blue
F161485-01 3 / PCK

Pipetman Comfort Handle Blue

Sign In for Pricing
View Details
Pipetman Comfort Handle Blue
F161485-02 50 / PCK

Pipetman Comfort Handle Blue

Sign In for Pricing
View Details
Muskelin (C-12) : m-IgG Fc BP-HRP Bundle
sc-527834 1 Kit

Muskelin (C-12) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Porcine Monocyte Chemotactic Protein 5 ELISA Kit
MBS750132-01 48 Well

Porcine Monocyte Chemotactic Protein 5 ELISA Kit

Sign In for Pricing
View Details