Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKCB Peptide - C-terminal region

PRKCB Peptide - C-terminal region

Product Specifications

Product Name Alternative

PKCB, PRKCB1, PRKCB2, PKC-beta

UniProt

P05771

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_997700.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRDTSNF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus epidermidis Prolipoprotein diacylglyceryl transferase (lgt)
MBS7018752-01 0.02 mg

Recombinant Staphylococcus epidermidis Prolipoprotein diacylglyceryl transferase (lgt)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis Prolipoprotein diacylglyceryl transferase (lgt)
MBS7018752-02 0.1 mg

Recombinant Staphylococcus epidermidis Prolipoprotein diacylglyceryl transferase (lgt)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis Prolipoprotein diacylglyceryl transferase (lgt)
MBS7018752-03 5x 0.1 mg

Recombinant Staphylococcus epidermidis Prolipoprotein diacylglyceryl transferase (lgt)

Sign In for Pricing
View Details
Human LLPH shRNA Plasmid
abx963420-01 150 µg

Human LLPH shRNA Plasmid

Sign In for Pricing
View Details
Human LLPH shRNA Plasmid
abx963420-02 300 µg

Human LLPH shRNA Plasmid

Sign In for Pricing
View Details
MAP3K9 Rabbit Polyclonal Antibody (BF680)
orb2451876 100 µL

MAP3K9 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details