Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGES3 Peptide - middle region

PTGES3 Peptide - middle region

Product Specifications

Product Name Alternative

P23, TEBP, cPGES

UniProt

Q15185

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001269530.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cell Navigator® Live Cell Endoplasmic Reticulum (ER) Staining Kit *Blue Fluorescence*
22634-AAT 100 Tests

Cell Navigator® Live Cell Endoplasmic Reticulum (ER) Staining Kit *Blue Fluorescence*

Sign In for Pricing
View Details
Ecteinascidin 770
TRC-E225900-1MG 1 mg

Ecteinascidin 770

Sign In for Pricing
View Details
NFYC Antibody
8C17136-AAT 50 µg

NFYC Antibody

Sign In for Pricing
View Details
Rhophilin 2 (RHPN2) Rabbit Polyclonal Antibody
TA371044 100 µL

Rhophilin 2 (RHPN2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ACSL5 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D4]
TA811872AM 100 µL

ACSL5 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D4]

Sign In for Pricing
View Details
Guanine nucleotide-binding protein alpha-q / GNAQ / G-ALPHA-q (GNAQ/2434), CF640R conjugate, 0.1mg/mL
BNC402434-500 1x 500 µL

Guanine nucleotide-binding protein alpha-q / GNAQ / G-ALPHA-q (GNAQ/2434), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details