What is the catalog number for MPG Peptide - middle region?

The catalog number for MPG Peptide - middle region is orb1997907.

What sizes are available for MPG Peptide - middle region?

MPG Peptide - middle region is available in the following size(s): 100 µg.

Is MPG Peptide - middle region in stock?

MPG Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

MPG Peptide - middle region

Product Specifications

UniProt

P23571

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VETEAYLGPEDEAAHSRGGRQTPRNRGMFMKPGTLYVYLIYGMYFCLNVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TP502286 20 µg

Fbxo44 (BC028884) Mouse Recombinant Protein

Sign In for Pricing

View Details

MBS7270436-01 48 Well

Guinea Pig Anti Angiotensin II Receptor 1 IgG Antibody ELISA Kit

Sign In for Pricing

View Details

MBS7270436-02 96 Well

Guinea Pig Anti Angiotensin II Receptor 1 IgG Antibody ELISA Kit

Sign In for Pricing

View Details

MBS7270436-03 5x 96 Well

Guinea Pig Anti Angiotensin II Receptor 1 IgG Antibody ELISA Kit

Sign In for Pricing

View Details

MBS7270436-04 10x 96 Well

Guinea Pig Anti Angiotensin II Receptor 1 IgG Antibody ELISA Kit

Sign In for Pricing

View Details

CF805831 100 µg

Gemin 8 (GEMIN8) Mouse Monoclonal Antibody [Clone ID: OTI4E11]

Sign In for Pricing

View Details